30-MINUTE MEALS! Get the email series now →
MrsRecipe

Amazing Chicken Casserole

5 from 1 vote
1 Comments
Clara Jennings
By: Clara JenningsUpdated: Oct 5, 2026
This post may contain affiliate links. Please read our disclosure policy.

A creamy, cheesy chicken and pasta casserole that hits all the comfort notes. Quick to assemble, family friendly, and perfect for weeknight dinners or potlucks.

Amazing Chicken Casserole

This recipe has been a weeknight lifesaver and a potluck favorite in my home for years. I first put this combination together on a rainy Thursday evening when the pantry had cooked pasta and leftover chicken and I wanted something that felt indulgent but still used what I had on hand. The result was an ultra creamy, cheesy bake with tender chicken and a golden, bubbling top that keeps everyone coming back for seconds. The texture balances soft pasta, saucy pockets of cheese, and slightly crisped edges from baking.

What makes this casserole special is its flexibility and the comforting familiarity of its flavors. It is simple enough to come together in under 45 minutes if the chicken and pasta are already cooked, yet sophisticated in its use of a light roux and sour cream to create a smooth, clingy sauce. I still remember my neighbor walking in on the aroma and insisting I hand over the recipe. Over time I have learned little tricks to keep the sauce velvety and to prevent the top from drying out while creating that perfect golden finish.

Why You'll Love This Recipe

  • This is ready from start to oven in about 15 minutes when using pre cooked chicken and pasta, and finishes in 25 minutes in the oven making it ideal for busy evenings.
  • It relies on pantry staples and common refrigerator items: pasta, cheese, milk, butter, and a little flour to thicken the sauce, so you rarely need a trip to the store.
  • The texture is irresistible a creamy interior with a lightly browned cheese topping; the reserved cheese gives you that melty, golden finish everyone notices first.
  • Make ahead friendly: assemble a day in advance, store in the fridge, then bake when ready which makes it excellent for entertaining and meal planning.
  • Customizable to suit families: swap cheeses, add vegetables, or add a crunchy breadcrumb top for texture contrast without losing the core flavor profile.

In my home the steady stream of compliments started the first time I served it for an informal Sunday dinner. My kids asked for it three times that week and my sister requested it for a holiday side. The ease of changing the cheese mix and folding in leftover vegetables has made this a recipe I reach for any time I want comfort food without fuss.

Ingredients

  • Cooked chicken 2 cups: Use leftover roasted or poached chicken cut into bite sized pieces. Rotisserie chicken works wonderfully for convenience and a rich flavor. Aim for white meat if you prefer a milder taste.
  • Cooked pasta 4 cups: This is about 2 cups uncooked. Use short shapes such as penne, cavatappi, or rigatoni which trap sauce. Cook to just al dente so the pasta does not go mushy during baking.
  • Butter 3 tablespoons: For the roux base. Unsalted allows control of seasoning; use salted if that is what you have and cut the added salt slightly.
  • Onion 1 small: Finely chopped for sweetness and depth. Yellow onion is classic for casseroles, but sweet onion will mellow the bite.
  • Garlic 2 cloves: Minced fresh garlic provides aromatic lift. Avoid pre minced in oil for fresher flavor.
  • All purpose flour 2 tablespoons: Thickens the sauce. Measure by spooning into the cup for accuracy or use a digital scale for precision.
  • Sour cream 1/2 cup: Adds tang and silkiness. Full fat gives the creamiest result but low fat will still work.
  • Milk 1 cup: Whole milk creates a richer sauce. If using 2 percent expect slightly thinner texture and consider an extra tablespoon of flour if needed.
  • Cheese 3 cups grated: Choose sharp cheddar, Colby jack, Swiss, or a mix. Reserve 1/2 cup for the top. Freshly grate for best melt and flavor.
  • Red pepper flakes 1/2 teaspoon: Brightens the dish with a gentle heat. Omit or reduce for children or spice averse eaters.
  • Salt and black pepper: To taste. I start with about 1 teaspoon kosher salt and 1/4 teaspoon black pepper for the whole casserole and adjust before baking.

Instructions

Preheat oven and prepare dish Preheat the oven to 350 degrees Fahrenheit. Lightly grease a 9x13 inch baking dish or spray with nonstick cooking spray to prevent sticking and make cleanup easier. Preheating ensures even baking and a consistent bubbling finish. Sauté aromatics In a large skillet melt 3 tablespoons butter over medium heat. Add the finely chopped onion and minced garlic and sauté until softened and fragrant, about 3 to 4 minutes. Look for translucent edges on the onion and a sweet, savory scent from the garlic without any browning. Make a roux and sauce Stir in 2 tablespoons flour and cook for about 1 minute while stirring. This cooks the raw flour taste away. Slowly whisk in 1 cup milk and then add 1/2 cup sour cream. Continue whisking until the sauce begins to thicken, about 3 to 4 minutes at a gentle simmer. The sauce should coat the back of a spoon. Incorporate cheese and seasonings Remove the pan from heat and stir in 2 1/2 cups of the grated cheese until smooth. Add 1/2 teaspoon red pepper flakes, and salt and black pepper to taste. Keep the heat low to prevent the cheese from becoming grainy. Combine pasta and chicken Add the cooked chicken and 4 cups cooked pasta to the sauce and toss until evenly coated. Ensure pieces of chicken are bite sized so they warm through evenly without drying. Assemble and bake Transfer the mixture to the prepared 9x13 inch baking dish. Sprinkle the reserved 1/2 cup cheese evenly across the top. Bake in the preheated oven for 20 to 30 minutes or until the top is bubbling and golden brown. Let rest for 5 minutes before serving so the sauce sets slightly. User provided content image 1

You Must Know

  • This holds well in the refrigerator for up to 3 days when covered tightly and reheats beautifully in a 350 degrees Fahrenheit oven until warmed through.
  • Freeze portions for up to 3 months. Thaw overnight in the fridge and bake until hot for best texture.
  • High in protein from the chicken and cheese; it is not dairy free or gluten free as written due to milk, sour cream, and flour.
  • If the sauce becomes too thick after resting, loosen it with a splash of milk while reheating to regain a silky texture.

My favorite part of serving this dish is watching people scoop a portion and reluctantly pause at the steam rising from the casserole before digging back in. Over the years I have learned to keep a small bowl of extra red pepper flakes and chopped parsley nearby so guests can customize heat and brightness. The straightforward technique makes this a reliable dish I share with friends who are new to cooking.

User provided content image 2

Storage Tips

Store any leftovers in an airtight container in the refrigerator for up to 3 days. For best results, portion into individual containers to reheat single servings more evenly. When reheating, cover the container loosely and heat at 350 degrees Fahrenheit for 15 to 20 minutes until warmed through. If refrigerated sauce has thickened, stir in 1 to 2 tablespoons of milk before reheating to restore creaminess. For freezing, cool completely then wrap the baking dish tightly with plastic wrap and foil or transfer to a freezer safe container for up to 3 months.

Ingredient Substitutions

To make this lighter, substitute Greek yogurt for half the sour cream and use 2 percent milk. For a gluten free version, replace the all purpose flour with a 1 to 1 gluten free flour blend or use cornstarch to thicken the sauce, mixing 1 tablespoon cornstarch with a little cold milk before whisking into the hot liquid. Swap cheeses to change flavor profile: Gruyere or smoked gouda add depth while Monterey jack keeps a milder melt. For a vegetarian variation double the vegetables and use a plant based chicken substitute but note the dairy remains unless substituted.

Serving Suggestions

Serve hot with a crisp green salad dressed lightly in lemon vinaigrette to cut through the richness. A side of steamed green beans or roasted broccoli complements the cheesy texture. For a heartier meal, pair with crusty bread or garlic knots. Garnish with chopped fresh parsley or chives and a light sprinkle of extra red pepper flakes for heat. For potlucks serve directly from the baking dish on a trivet with a serving spoon so guests can help themselves.

Cultural Background

This style of baked pasta and protein casserole is rooted in comfort food traditions across many cultures where combining starch, sauce, and protein into a single dish is a practical and convivial approach to family meals. In American kitchens casseroles became especially popular in the mid 20th century as convenient ways to feed families, often using leftover ingredients. The use of a basic roux and cheese connects to classic French techniques while the baked assembly mirrors traditional gratin approaches in European cooking.

Seasonal Adaptations

Adapt this dish through the year by folding in seasonal vegetables. In spring add asparagus tips and peas. In summer fold in roasted zucchini and cherry tomatoes. In autumn incorporate roasted squash and sage and in winter add spinach or kale and a sprinkle of nutmeg to the sauce for warmth. Each seasonal change alters the flavor while preserving the comforting base of chicken and cheese.

Meal Prep Tips

For efficient meal prep, cook the pasta and chicken the day before and store separately. Prepare the sauce and combine everything in the baking dish, then cover and refrigerate. When ready to serve, simply bake as directed. To convert to single serving meal prep, divide into six 2 cup portions in oven safe containers and refrigerate. Reheat covered at 350 degrees Fahrenheit until hot, checking after 12 to 15 minutes for individual portions.

Making this casserole is an easy way to turn simple ingredients into something memorable. It rewards small attentions like freshly grated cheese and careful seasoning and invites experimentation. Share it at a family dinner and enjoy the easy conversation that comes with a comforting, crowd pleasing dish.

Pro Tips

  • Cook the pasta to just al dente to avoid a mushy final texture after baking.

  • Reserve some cheese for the top so the casserole develops a golden, bubbling finish.

  • If the sauce thickens too much after resting, loosen with a splash of milk while reheating.

This nourishing amazing chicken casserole recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Family Dinnerschickencasserolepastadinnerweeknightfamily-friendly
No ratings yet

Amazing Chicken Casserole

This Amazing Chicken Casserole recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Amazing Chicken Casserole
Prep:15 minutes
Cook:25 minutes
Rest Time:10 mins
Total:40 minutes

Ingredients

Main

Topping

Instructions

1

Preheat and prepare

Preheat oven to 350 degrees Fahrenheit. Grease a 9x13 inch baking dish to prevent sticking.

2

Sauté aromatics

Melt butter in a large skillet over medium heat. Add finely chopped onion and minced garlic and cook until softened, about 3 to 4 minutes.

3

Make roux and sauce

Stir in flour and cook for 1 minute. Slowly whisk in milk and sour cream and simmer until the sauce thickens, about 3 to 4 minutes.

4

Add cheese and season

Remove from heat and stir in most of the grated cheese until smooth. Season with red pepper flakes, salt, and black pepper to taste.

5

Combine pasta and chicken

Add cooked chicken and pasta to the sauce, tossing gently until everything is evenly coated.

6

Assemble and bake

Transfer mixture to the prepared dish, top with reserved cheese, and bake 20 to 30 minutes until bubbly and golden. Let rest 5 minutes before serving.

★

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 520kcal | Carbohydrates: 38g | Protein:
35g | Fat: 26g | Saturated Fat: 8g |
Polyunsaturated Fat: 5g | Monounsaturated Fat:
10g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@mrsrecipe on social media!

Amazing Chicken Casserole

Categories:

Amazing Chicken Casserole

Did You Make This?

Leave a comment & rating below or tag @mrsrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:★★★★★

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Clara!

Chef and recipe creator specializing in delicious Family Dinners cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.