30-MINUTE MEALS! Get the email series now →
MrsRecipe

Crispy Chicken Wonton Tacos

5 from 1 vote
1 Comments
Clara Jennings
By: Clara JenningsUpdated: Oct 5, 2026
This post may contain affiliate links. Please read our disclosure policy.

Crunchy fried wonton shells filled with savory teriyaki chicken, crisp slaw and a sweet-spicy drizzle—an irresistible party bite that comes together in under 30 minutes.

Crispy Chicken Wonton Tacos

This recipe for Crispy Chicken Wonton Tacos is one I started making when I needed a fast, crowd-pleasing snack for a last-minute gathering. I first tossed this together the week my neighborhood book club asked everyone to bring finger food. I had chicken in the fridge, a bag of wonton wrappers in the freezer, and a jar of sweet chili sauce on the counter. The combination of a hot, crunchy shell with warm, savory chicken and cool, tangy slaw made these vanish within minutes. Since then they have become my go-to answer for casual parties and weeknight dinners that feel a little festive.

What makes these bites special is the contrast: crunchy, golden wonton shells give way to juicy slices of teriyaki-marinated chicken folded into a fresh, crisp slaw. The sesame oil and ginger add depth while the sweet chili sauce provides a bright finish. I learned to keep the filling simple so each component can shine—lean chicken, bold flavors, and a slaw with rice vinegar to cut the richness. Every time I make them, someone asks for the recipe and another asks if I can double the batch.

Why You'll Love This Recipe

  • Ready quickly: from start to finish in about 25 to 30 minutes, perfect for last-minute guests or busy weeknights.
  • Uses pantry staples: wonton wrappers, teriyaki and soy sauce are common pantry items—no specialty shopping required.
  • Textural contrast: crunchy fried shells paired with tender chicken and a refreshing cabbage-carrot slaw create a balanced bite.
  • Make-ahead friendly: the chicken and slaw can be prepared ahead and reheated or served cold to speed assembly.
  • Crowd-pleasing and customizable: mild enough for kids but easy to spice up for adults with additional chili or sriracha.

My family responded to these with genuine surprise the first time I served them: my father declared them better than the takeout we used to order, and my daughter ate four before I could plate them properly. They travel well to potlucks and are perfect to set out on a platter for grazing.

Ingredients

  • Boneless skinless chicken breasts (2): Thinly sliced across the grain so the meat cooks quickly and remains tender; use about 1 pound total. I like a lean, fresh chicken breast from a local butcher for best texture.
  • Teriyaki sauce (1/4 cup): A good bottled teriyaki like Kikkoman or homemade reduced teriyaki adds umami and sweetness—this is the backbone of the marinade.
  • Sesame oil (1 tablespoon, divided): Use toasted sesame oil for flavor; split the amount so some flavors go into the chicken and some finish the slaw.
  • Low-sodium soy sauce (1 tablespoon): Balances salt without overpowering; choose low-sodium so the marinade stays balanced.
  • Garlic (2 cloves), fresh ginger (1 teaspoon): Mince garlic and grate fresh ginger for the best aromatic punch—powdered substitutes are less vibrant.
  • Coleslaw mix (2 cups): Pre-shredded cabbage and carrots save time and provide a crisp counterpoint to the warm chicken.
  • Green onions (2): Thinly sliced for a bright scallion bite in the slaw and as garnish.
  • Rice vinegar (1 tablespoon) and honey (1 teaspoon): These dress the slaw with a little acidity and gentle sweetness to complement the teriyaki.
  • Wonton wrappers (12): Look for the square wrappers in the refrigerated section; they fry quickly into crisp taco shells.
  • Sweet chili sauce (2 tablespoons): For drizzling—pick a brand you like because it finishes the bites with heat and sweetness.
  • Sesame seeds (1 teaspoon) and cilantro (2 tablespoons, chopped): Final garnish for color, texture and fresh herbal lift.

Instructions

Marinate the chicken: Combine 1/4 cup teriyaki sauce, 1/2 tablespoon sesame oil, 1 tablespoon low-sodium soy sauce, 2 minced garlic cloves and 1 teaspoon grated ginger in a shallow bowl. Add thinly sliced chicken, toss to coat and let sit for 10 minutes at room temperature. Short marination penetrates flavor without turning the meat mushy. Cook the protein: Heat 1/2 tablespoon sesame oil in a nonstick skillet over medium heat. Add the marinated chicken in a single layer and cook, stirring occasionally, until cooked through and browned in spots, about 5 to 7 minutes. Aim for an internal temperature of 165°F; let rest 2 minutes, then slice into bite-size pieces. Make the slaw: In a medium bowl, toss 2 cups coleslaw mix with 2 thinly sliced green onions, 1 tablespoon rice vinegar and 1 teaspoon honey along with the remaining sesame oil. Taste and adjust acid or sweetness—slaw should be bright and slightly tangy to cut the richness of the chicken. Fry the wrappers: Pour about 1/2 inch of neutral oil into a wide skillet and heat to 350°F (medium-high). Fry each wonton wrapper for 20 to 30 seconds per side until golden and crisp. Use tongs to shape them slightly into taco shells while warm and drain on paper towels to remove excess oil. Assemble the tacos: Place sliced chicken into each crispy shell, top with a spoonful of slaw and drizzle with sweet chili sauce. Sprinkle sesame seeds and chopped cilantro across the platter. Serve immediately for optimal crunch. User provided content image 1

You Must Know

  • These bites are best eaten the same day: the shells lose their crunch if stored assembled for longer than an hour.
  • You can make the chicken and slaw ahead: refrigerate separately for up to 2 days and fry the shells just before serving.
  • Freezing fried shells is not recommended because they will soften; the uncooked wonton wrappers freeze well for months.
  • High in protein and relatively low in calories per piece—roughly 180 to 220 calories each, depending on oil absorption.

My favorite aspect is how quickly this comes together when I already have ingredients on hand: I once assembled a full platter in under 20 minutes between finishing laundry and making tea. Guests always comment on the crunch and the tang of the slaw; it’s proof that simple contrasts make memorable food.

User provided content image 2

Storage Tips

If you have leftovers, keep the components separate. Store cooked chicken in an airtight container in the refrigerator for up to 3 days. The slaw will keep well for 2 to 3 days, though it will soften slightly as the acid breaks down the cabbage. Keep fried shells at room temperature in a single layer inside a paper-towel lined container for up to 12 hours; avoid refrigeration which makes them soggy. To re-crisp shells, flash-fry for 10 to 15 seconds or warm in a 350°F oven for 3 to 5 minutes.

Ingredient Substitutions

For a gluten-free option, replace wonton wrappers with small gluten-free corn tortillas that you can crisp in oil, and swap soy sauce for tamari. If you prefer dark-meat flavor, use thinly sliced boneless thighs but reduce cooking time slightly. For less oil, bake wrappers at 400°F on a lightly oiled sheet for 6 to 8 minutes per side until golden, though the texture differs from frying. Swap sweet chili sauce for spicy mayo or teriyaki glaze according to preference.

Serving Suggestions

Serve these as an appetizer on a large platter garnished with extra cilantro and lime wedges. Pair them with a crisp pilsner or chilled white wine like a dry Riesling. For a meal, add a side bowl of steamed edamame or a miso-cucumber salad. Garnish ideas include sliced jalapeños, toasted sesame seeds, pickled red onions, or a drizzle of sriracha-mayo for heat and creaminess.

Cultural Background

These handheld bites are a playful fusion of East Asian flavors and American finger-food tradition. Wonton wrappers and teriyaki originate in Chinese and Japanese cuisines respectively; my version borrows the wrapper technique and pairs it with slaw and sweet chili, reflecting the cross-cultural creativity common in modern home cooking. Similar concepts appear in Asian-fusion restaurants where familiar textures are reimagined in approachable ways.

Seasonal Adaptations

In warmer months, swap the cabbage slaw for a mango-jicama salsa to add bright, tropical notes. During colder weather, serve the chicken warm with a warm sesame-scallion slaw and a soy-ginger glaze for extra comfort. Holiday parties benefit from using mini wonton wrappers for bite-sized hors d'oeuvres and serving a trio of sauces—sweet chili, teriyaki glaze and spicy aioli—so guests can choose their favorite.

Meal Prep Tips

To meal-prep, slice and marinate chicken and portion into containers; keep slaw components separate but pre-mixed with dressing if consuming within 24 hours. Store fried shells in a dry, airtight container with paper towels between layers to absorb residual oil and maintain crunch. Assemble only the number you will eat to avoid soggy shells, and keep extra sauce on the side for individual drizzling.

These crispy tacos are one of those versatile recipes I find myself returning to again and again. They travel well, scale up easily, and invite experimentation with heat and garnish. I hope you enjoy making them as much as I enjoy sharing them—there’s a simple joy in handing someone a perfectly crunchy bite and watching the smile that follows.

Pro Tips

  • Pat chicken dry before slicing so the marinade adheres better and the meat browns evenly.

  • Heat oil to the correct temperature (about 350°F) before frying wontons to minimize oil absorption.

  • Make slaw no more than a few hours ahead to keep it crisp; add dressing just before serving if preparing a day ahead.

  • Use a thermometer to ensure chicken reaches 165°F for food safety without overcooking.

This nourishing crispy chicken wonton tacos recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Family Dinnersrecipesnackappetizerseasyweeknightfamily-friendlycrowd-pleaser
No ratings yet

Crispy Chicken Wonton Tacos

This Crispy Chicken Wonton Tacos recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Crispy Chicken Wonton Tacos
Prep:10 minutes
Cook:15 minutes
Rest Time:10 mins
Total:25 minutes

Ingredients

Protein & Marinade

Slaw

Assembly & Garnish

Instructions

1

Marinate the chicken

Combine teriyaki sauce, 1/2 tablespoon sesame oil, soy sauce, garlic and ginger. Add thinly sliced chicken and toss to coat. Let sit for 10 minutes at room temperature so flavors penetrate without breaking down the meat.

2

Cook the chicken

Heat remaining 1/2 tablespoon sesame oil in a nonstick skillet over medium heat. Add chicken in a single layer and cook 5 to 7 minutes until cooked through and browned. Aim for an internal temperature of 165°F; rest briefly then slice into bite-sized pieces.

3

Prepare the slaw

Toss coleslaw mix, sliced green onions, rice vinegar, honey and remaining sesame oil in a bowl until evenly coated. Adjust acidity to taste; slaw should be bright and refreshing to balance the fried shells.

4

Fry the wonton wrappers

Heat neutral oil in a wide skillet to medium-high (about 350°F). Fry each wonton for 20 to 30 seconds per side until golden and crisp. Shape into taco forms while warm and drain on paper towels to remove excess oil.

5

Assemble and garnish

Fill each crispy shell with sliced chicken and a spoonful of slaw. Drizzle with sweet chili sauce and finish with sesame seeds and chopped cilantro. Serve immediately for best texture.

★

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 200kcal | Carbohydrates: 12g | Protein:
15g | Fat: 7g | Saturated Fat: 2g |
Polyunsaturated Fat: 1g | Monounsaturated Fat:
3g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@mrsrecipe on social media!

Crispy Chicken Wonton Tacos

Categories:

Crispy Chicken Wonton Tacos

Did You Make This?

Leave a comment & rating below or tag @mrsrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:★★★★★

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Clara!

Chef and recipe creator specializing in delicious Family Dinners cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.