30-MINUTE MEALS! Get the email series now
MrsRecipe

Garlic Parmesan Chicken Soup

5 from 1 vote
1 Comments
Clara Jennings
By: Clara JenningsUpdated: Aug 7, 2026
This post may contain affiliate links. Please read our disclosure policy.

A creamy, comforting bowl of garlic and Parmesan scented chicken soup that comes together quickly using pantry staples and fresh greens for a family favorite.

Garlic Parmesan Chicken Soup

This Garlic Parmesan Chicken Soup arrived in my weeknight rotation during a cold, busy season when I wanted something quick, nourishing, and utterly comforting. I first combined these simple pantry staples one evening after a long day at work, and the warm, garlicky aroma had my family gathered at the counter before I even ladled the first bowl. The texture balances tender bite sized chicken, silky cream, and finely grated Parmesan for a bowl that feels indulgent yet homey.

I remember the first time I served it to my inlaws. They had expected plain broth and instead found a rich, savory blend that tasted like a restaurant but felt like home. The garlic pops without being harsh, and the Parmesan melts into the broth to thicken it naturally, so you do not need a roux. When I add a handful of fresh spinach the color brightens and the soup becomes a one pot complete dinner that kids and adults both ask for again and again.

Why You'll Love This Recipe

  • This comes together quickly with about 15 minutes active prep and under 30 minutes total, ideal for busy weeknights and last minute dinners.
  • Uses pantry staples and a few fresh items, meaning you can make it without a special shopping trip; Parmesan and heavy cream carry the richness so simple ingredients shine.
  • Protein forward and family friendly, the bite sized chicken pieces cook fast and make portions easy to serve to children or guests.
  • Make ahead and reheat well; the flavors deepen if you let it rest one day, and it reheats in a pot or microwave without separating when stirred gently.
  • Flexible for dietary swaps: use half and half or a dairy free cream alternative if needed, and add greens for vitamins without changing the beloved flavor profile.
  • Comforting texture from melted Parmesan means no flour or cornstarch is required for a velvety finish.

I learned to time the garlic carefully so it flavors the oil but does not burn, and that slowly adding grated cheese while stirring prevents graininess. My family calls this the soup that fixes everything, and it has been requested for birthdays, sick days, and late winter dinners when everyone wants something warm and familiar.

Ingredients

  • Olive oil: Use extra virgin olive oil for the initial sauté. It adds fragrance and helps caramelize the onion. Two tablespoons are all you need, choose a bright, fruity brand for the best aroma.
  • Onion: One medium onion, chopped. Yellow or sweet onion works well. The onion softens and builds the savory base, aim for translucent pieces not browned.
  • Garlic: Four cloves, minced. Fresh garlic is essential for that sharp roasted garlic flavor. Add it briefly so it becomes fragrant without turning bitter.
  • Chicken breast: One pound boneless, skinless, cut into about one inch cubes. Chicken breasts cook quickly and stay tender when not overcooked. You can use pre-cut chicken from the butcher to save time.
  • Chicken broth: Four cups low sodium broth. Using low sodium gives you more control over seasoning. Rich homemade or a well reviewed commercial brand both work.
  • Heavy cream or half and half: One cup. Heavy cream makes it richer; half and half lightens calories and still gives creaminess. Add at low heat to avoid curdling.
  • Parmesan cheese: One cup grated. I recommend Parmigiano Reggiano for depth and a slightly nutty flavor. Freshly grated melts smoothly compared with pre grated powder.
  • Dried thyme and dried basil: One teaspoon each. They provide a gentle herbal backdrop that complements Parmesan without overpowering the garlic.
  • Salt and pepper: To taste. Season at the end so the broth does not become too salty from the cheese.
  • Fresh parsley: For garnish. Adds a bright herbal finish and lifts the bowl visually.
  • Fresh spinach or kale: Two cups optional. Stirred in at the end, they wilt quickly and add color and nutrients.
User provided content image 2

Instructions

Sauté the aromatics Heat two tablespoons olive oil in a large pot over medium heat. Add the chopped onion and cook for about five minutes until softened and translucent. Stir in minced garlic and cook for one to two minutes until fragrant. Watch the garlic closely to prevent burning which creates bitterness. Brown the chicken Add the bite sized chicken pieces to the pot. Season with salt and pepper and cook for five to seven minutes, stirring occasionally. You want the outside to lose its pink color and begin to turn lightly golden. This step seals juices and adds a little caramelized flavor. Simmer in broth Pour in four cups chicken broth and add one teaspoon dried thyme and one teaspoon dried basil. Bring the pot to a gentle boil then lower heat to a simmer. Let it cook for ten to fifteen minutes so the chicken cooks through and the flavors meld. Taste the broth for seasoning adjustments before adding dairy. Finish with cream and cheese Reduce heat to low and stir in one cup heavy cream or half and half. Add grated Parmesan gradually, about a quarter cup at a time, stirring constantly to allow it to melt into a smooth, creamy consistency. Keep the temperature low to prevent the dairy from separating and to ensure a velvety texture. Wilt the greens and serve If using, add two cups fresh spinach or kale and stir until wilted, about one to two minutes. Taste and correct seasoning with additional salt and pepper. Ladle into bowls and garnish with extra Parmesan and chopped fresh parsley. Serve hot with crusty bread or a simple salad. User provided content image 1

You Must Know

  • This keeps well refrigerated for three to four days. Cool quickly, store in airtight containers, and reheat gently over low heat with a splash of water or broth to loosen the texture.
  • Freezes well for up to three months. Leave out the greens and add them fresh when reheating for best texture.
  • High in protein and comforting fat from cream and Parmesan. Adjust cream amount or use half and half to lower calories.
  • Use freshly grated Parmesan to avoid a grainy texture; add cheese gradually while stirring to ensure a smooth finish.
  • If using store bought broth, choose low sodium to control final salt level because the cheese contributes saltiness.

My favorite part is the way the kitchen fills with garlic and warmed cheese. Once, I made a double batch for a potluck and everyone asked for the recipe. The soup also became my go to when friends needed something nourishing brought to them during busy or stressful weeks. It is reliable, quick, and somehow always soothing.

Storage Tips

Cool leftovers within two hours and transfer to shallow airtight containers before refrigerating. Stored properly this keeps three to four days. For freezing, portion into microwave safe or oven safe containers leaving one inch headspace so liquids can expand. Freeze up to three months. Reheat slowly over low heat, stirring occasionally, and add a splash of broth or water if the consistency tightens. Do not boil after adding cream, keep the temperature just below a simmer to preserve a silky texture.

Ingredient Substitutions

If you need a lighter version use half and half or a mixture of whole milk and a tablespoon of cornstarch to approximate creaminess. For a dairy free option choose an unsweetened oat cream and a dairy free grated alternative, though flavor will be milder. Swap chicken breasts for boneless thighs for juicier results, adjust cooking time by a few minutes. Use vegetable broth and omit cheese for a vegetarian friendly version, then finish with a splash of olive oil and extra herbs for richness.

Serving Suggestions

Serve with crusty bread, garlic knots, or a simple green salad to balance the richness. Garnish with extra grated Parmesan and chopped parsley for color and brightness. For a heartier plate add roasted vegetables or a smear of pesto on toasted bread. This bowl is perfect for a cozy family dinner, a night in with friends, or when you need a comforting solo meal.

Cultural Background

This soup combines Italian influenced elements such as Parmesan and basil with classic American one pot comfort. It is not a traditional regional dish but rather a modern comfort combination rooted in simple European techniques that emphasize quality cheese and garlic. The method of finishing a broth with cheese and cream is common in many family kitchens where richness and speed are both valued.

Seasonal Adaptations

In winter add chopped root vegetables like carrots and celery in the sauté stage for extra body and nutrients. In spring and summer swap kale for tender baby spinach and finish with lemon zest for brightness. For autumn, stir in roasted butternut squash cubes and a pinch of nutmeg to echo fall flavors. These small changes adapt the same technique to seasonal produce.

Meal Prep Tips

Portion into individual containers for grab and go lunches. Keep greens separate and add when reheating to preserve texture. If you plan a week of lunches, reduce cream slightly and add it fresh when reheating to maintain a silky finish. Label containers with the date and plan to consume refrigerated bowls within four days or freeze for longer storage.

Whether you make a small pot for a weeknight dinner or a double batch for guests, this bowl brings warmth and easy comfort to any table. Give it a try and make little adjustments to suit your family s taste. I hope it becomes a familiar favorite in your home as it is in mine.

Pro Tips

  • Grate Parmesan from a wedge rather than using pre grated powder to ensure smooth melting.

  • Add the cheese slowly while stirring over low heat to prevent clumping or grainy texture.

  • Use low sodium broth so you can control final seasoning, especially because Parmesan adds salt.

  • If reheating, stir in a small splash of broth or water to loosen the texture and avoid boiling after dairy is added.

This nourishing garlic parmesan chicken soup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

How long does this soup keep in the fridge?

Yes. Refrigerate leftovers within two hours and consume within three to four days. Reheat gently and add a splash of broth if needed.

Can I freeze this soup?

Freeze without greens for up to three months. Thaw in the refrigerator and reheat slowly on the stove.

Tags

Comfort Classicsrecipesoupchickengarlicparmesancreamyweeknight-dinnercomfort-food
No ratings yet

Garlic Parmesan Chicken Soup

This Garlic Parmesan Chicken Soup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Garlic Parmesan Chicken Soup
Prep:15 minutes
Cook:25 minutes
Rest Time:10 mins
Total:40 minutes

Ingredients

Main

Optional Greens

Instructions

1

Sauté the aromatics

Heat two tablespoons olive oil in a large pot over medium heat. Add chopped onion and cook about five minutes until softened and translucent. Stir in minced garlic and cook one to two minutes until fragrant, careful not to burn.

2

Brown the chicken

Add chicken pieces to the pot, season with salt and pepper, and cook five to seven minutes until the outside is no longer pink and begins to turn light golden.

3

Simmer in broth

Pour in four cups chicken broth and add dried thyme and dried basil. Bring to a gentle boil then reduce heat and simmer ten to fifteen minutes so chicken cooks through and flavors meld.

4

Finish with cream and cheese

Reduce heat to low and stir in one cup heavy cream or half and half. Gradually add grated Parmesan in quarter cup increments, stirring constantly until melted and soup is creamy.

5

Add greens and serve

If using, stir in two cups fresh spinach or kale until wilted about one to two minutes. Taste and adjust seasoning. Garnish with extra Parmesan and chopped parsley before serving.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 500kcal | Carbohydrates: 6g | Protein:
32g | Fat: 40g | Saturated Fat: 12g |
Polyunsaturated Fat: 8g | Monounsaturated Fat:
16g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@mrsrecipe on social media!

Garlic Parmesan Chicken Soup

Categories:

Garlic Parmesan Chicken Soup

Did You Make This?

Leave a comment & rating below or tag @mrsrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Clara!

Chef and recipe creator specializing in delicious Comfort Classics cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.